DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Gsto2

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001012071.1 Gene:Gsto2 / 309465 RGDID:1310764 Length:248 Species:Rattus norvegicus


Alignment Length:218 Identity:41/218 - (18%)
Similarity:82/218 - (37%) Gaps:55/218 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDG-NYIWD 67
            :.:|.:...|.....:|.|.|..:.:|.:|:|:..:   .:.|..|:|...||.||:.. ..|::
  Rat    24 IRIYSMRFCPYSHRTRLVLKAKSIRHEIININLKNK---PDWYYTKHPFGQVPVLENSQCQLIYE 85

  Fly    68 SHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERY 132
            |.....||...: ....|:|.|..:||  .|::..|               ||.    ::|:...
  Rat    86 SVIACEYLDDVF-PGRKLFPYDPYERA--RQKMLLE---------------LFC----KVPQLSK 128

  Fly   133 DAIV-----------------------EIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAF 174
            :.:|                       ||.::..|     .:..||.:::.|:.:......|..:
  Rat   129 ECLVALRCGRDCTDLKVALRQELCNLEEILEYQNT-----TFFGGDSISMIDYLVWPWFERLDVY 188

  Fly   175 VEIDRLKY-PRIIEWVRRLEKLP 196
            ...|.:.: |.:..|:..:::.|
  Rat   189 GLADCVNHTPMLRLWISSMKQDP 211

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 40/216 (19%)
Thioredoxin_like 4..77 CDD:294274 19/73 (26%)
GST_C_Delta_Epsilon 91..209 CDD:198287 19/130 (15%)
Gsto2NP_001012071.1 GST_N_Omega 7..94 CDD:239353 18/72 (25%)