DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Clic6

DIOPT Version :10

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_788267.2 Gene:Clic6 / 304081 RGDID:727938 Length:613 Species:Rattus norvegicus


Alignment Length:152 Identity:34/152 - (22%)
Similarity:65/152 - (42%) Gaps:43/152 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VNVNISGQEQLSEE------YLKKNPEHTVPTLEDDGNYIWDSHAIIAYLVSKYADSDALYPRDL 90
            |..:::..|:..||      |.|...:|  |.....||.::...:  |::.:...|::.:|.::|
  Rat   445 VKTDVNKIEEFLEEKLVPPRYPKLGTQH--PESNSAGNDVFAKFS--AFIKNTKKDANDIYEKNL 505

  Fly    91 LQRAV--VDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERYDAIVEIYDFVETFLAGHDYIA 153
            | ||:  :|..|:               .||        |.|     ::.|...:..::...::.
  Rat   506 L-RALKKLDSYLN---------------SPL--------PDE-----IDAYSTEDVTVSQRKFLD 541

  Fly   154 GDQLTIADFSLISS--ITSLVA 173
            ||:||:||.:|:..  |..:||
  Rat   542 GDELTLADCNLLPKLHIIKIVA 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..210 CDD:440390 34/152 (22%)
Clic6NP_788267.2 2A1904 <51..318 CDD:273344
O-ClC 380..613 CDD:129941 34/152 (22%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Y696 396..399
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.