Sequence 1: | NP_611327.1 | Gene: | GstE5 / 37110 | FlyBaseID: | FBgn0063495 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006241513.1 | Gene: | Mars1 / 299851 | RGDID: | 1305321 | Length: | 910 | Species: | Rattus norvegicus |
Alignment Length: | 204 | Identity: | 42/204 - (20%) |
---|---|---|---|
Similarity: | 82/204 - (40%) | Gaps: | 65/204 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 VNISGQEQLSEEYLKKNPEHTVPTLE-DDGNYIWDSHAIIAY--LVSKYADSDALYPRDLLQRAV 95
Fly 96 VDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERYDAIVE-------------IYDFVETFLA 147
Fly 148 GHD--YIAGDQLTIADFSLISSITSLV---AFV--EIDRLKYPRIIEWVRRLEKLPYYEEANAKG 205
Fly 206 ARELETILK 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE5 | NP_611327.1 | GstA | 4..196 | CDD:223698 | 36/184 (20%) |
Thioredoxin_like | 4..77 | CDD:294274 | 15/45 (33%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 22/137 (16%) | ||
Mars1 | XP_006241513.1 | Thioredoxin_like | 1..68 | CDD:294274 | 13/40 (33%) |
GstA | <47..189 | CDD:223698 | 35/182 (19%) | ||
GST_C_MetRS_N | 77..179 | CDD:198340 | 21/137 (15%) | ||
PRK12268 | 266..821 | CDD:237029 | |||
MetRS_core | 267..635 | CDD:173907 | |||
Anticodon_Ia_Met | 644..773 | CDD:153411 | |||
MetRS_RNA | 855..899 | CDD:238475 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |