DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Clic4

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_038913.1 Gene:Clic4 / 29876 MGIID:1352754 Length:253 Species:Mus musculus


Alignment Length:150 Identity:34/150 - (22%)
Similarity:62/150 - (41%) Gaps:39/150 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VNVNISGQEQLSEE------YLKKNPEHTVPTLEDDGNYIWDSHAIIAYLVSKYADSDALYPRDL 90
            |..:::..|:..||      |||.:|:|  |.....|..|:...:  ||:.:...:::....|.|
Mouse    84 VKTDVNKIEEFLEEVLCPPKYLKLSPKH--PESNTAGMDIFAKFS--AYIKNSRPEANEALERGL 144

  Fly    91 LQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERYDAIVEIYDFVETFLAGHDYIAGD 155
            |:..   |:|.           :.:..||        |.|..:..:|...|     :...::.||
Mouse   145 LKTL---QKLD-----------EYLNSPL--------PDEIDENSMEDIKF-----STRRFLDGD 182

  Fly   156 QLTIADFSLISS--ITSLVA 173
            ::|:||.:|:..  |..:||
Mouse   183 EMTLADCNLLPKLHIVKVVA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 33/149 (22%)
Thioredoxin_like 4..77 CDD:294274 14/50 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 17/84 (20%)
Clic4NP_038913.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 4/16 (25%)
O-ClC 17..252 CDD:129941 33/149 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.