DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Clic4

DIOPT Version :10

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_038913.1 Gene:Clic4 / 29876 MGIID:1352754 Length:253 Species:Mus musculus


Alignment Length:150 Identity:34/150 - (22%)
Similarity:62/150 - (41%) Gaps:39/150 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VNVNISGQEQLSEE------YLKKNPEHTVPTLEDDGNYIWDSHAIIAYLVSKYADSDALYPRDL 90
            |..:::..|:..||      |||.:|:|  |.....|..|:...:  ||:.:...:::....|.|
Mouse    84 VKTDVNKIEEFLEEVLCPPKYLKLSPKH--PESNTAGMDIFAKFS--AYIKNSRPEANEALERGL 144

  Fly    91 LQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERYDAIVEIYDFVETFLAGHDYIAGD 155
            |:..   |:|.           :.:..||        |.|..:..:|...|     :...::.||
Mouse   145 LKTL---QKLD-----------EYLNSPL--------PDEIDENSMEDIKF-----STRRFLDGD 182

  Fly   156 QLTIADFSLISS--ITSLVA 173
            ::|:||.:|:..  |..:||
Mouse   183 EMTLADCNLLPKLHIVKVVA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..210 CDD:440390 33/149 (22%)
Clic4NP_038913.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 4/16 (25%)
O-ClC 17..252 CDD:129941 33/149 (22%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Z0W7 35..38
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.