DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GSTT2

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_000845.2 Gene:GSTT2 / 2953 HGNCID:4642 Length:244 Species:Homo sapiens


Alignment Length:220 Identity:63/220 - (28%)
Similarity:100/220 - (45%) Gaps:31/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDSHAIIAYLV 76
            |.|.|||.:......:|.|...|::...:..|:|:|:.|....:|||:|....:.:|.||:.||.
Human    11 SQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLS 75

  Fly    77 SKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLN-----RIPKERYD--- 133
            .||...|..||.||..||.|.:.|.:....:  .|...|  ||:...|.     ::|||:.:   
Human    76 CKYQTPDHWYPSDLQARARVHEYLGWHADCI--RGTFGI--PLWVQVLGPLIGVQVPKEKVERNR 136

  Fly   134 -AIVEIYDFVE-TFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKY------PRIIEWVR 190
             |:.:...::| .||....::||.|:|:||...:..:...||      |.|      ||:..|..
Human   137 TAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVA------LGYELFEGRPRLAAWRG 195

  Fly   191 RLEKLPYYEEANAKGARELETILKS 215
            |:|..     ..|:..:|..:|:.|
Human   196 RVEAF-----LGAELCQEAHSIILS 215

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 59/199 (30%)
Thioredoxin_like 4..77 CDD:294274 21/64 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 32/133 (24%)
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 21/66 (32%)
GstA 14..210 CDD:223698 59/210 (28%)