DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Clic2

DIOPT Version :10

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001009651.1 Gene:Clic2 / 294141 RGDID:1306580 Length:245 Species:Rattus norvegicus


Alignment Length:165 Identity:33/165 - (20%)
Similarity:64/165 - (38%) Gaps:50/165 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLPYEFVNVNISGQEQLSEEYLKKN---PE--HTVPTLE---DDGNYIWDSHAIIAYLVSKYADS 82
            :|..:|:.:         ||:|:|.   |.  |..|..:   |.|..::...:  ||:.:...::
  Rat    78 ELKTDFIKI---------EEFLEKTLAPPRYPHLSPKYKESFDVGCNLFAKFS--AYIKNTQKEA 131

  Fly    83 DALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERYDAIVEIYDFVETFLA 147
            :..:.:.||:.              |......:..||    |:.|..:..:         |..|:
  Rat   132 NKNFEKSLLRE--------------FKRLDDYLNTPL----LDEIDPDSTE---------ERTLS 169

  Fly   148 GHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKY 182
            ...::.|||||:||.||:..:.    .:::...||
  Rat   170 RRLFLDGDQLTLADCSLLPKLN----IIKVAAKKY 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..210 CDD:440390 33/165 (20%)
Clic2NP_001009651.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 6/26 (23%)
O-ClC 12..245 CDD:129941 33/165 (20%)
G-site. /evidence=ECO:0000250|UniProtKB:O15247 30..33
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.