DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Eef1g

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001004223.1 Gene:Eef1g / 293725 RGDID:1302939 Length:437 Species:Rattus norvegicus


Alignment Length:253 Identity:61/253 - (24%)
Similarity:93/253 - (36%) Gaps:87/253 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RAVKLTLAA---------LQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLE-DDGNYIWDSHA 70
            ||.|..:||         |..|..|    ..||...:.|:|:|.|...||..| |||..:::|:|
  Rat    14 RAFKALIAAQYSGAQIRVLSAPPHF----HFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNA 74

  Fly    71 IIAYLVS-------------------KYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAIT 116
             |||.||                   .:||||.:.|.              .|.|....||....
  Rat    75 -IAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPA--------------STWVFPTLGIMHHN 124

  Fly   117 KPLFFNGLNRIPKERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLV--------- 172
            |....|.     ||....|:.:.|   |.|....::.|:::|:||.:::.::..|.         
  Rat   125 KQATENA-----KEEVKRILGLLD---THLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFR 181

  Fly   173 -AFVEIDR-----LKYPR---IIEWVRRLEKLPYYE-------------EANAKGARE 208
             ||...:|     :..|:   |:..|:..||:..::             ....||:||
  Rat   182 QAFPNTNRWFLTCINQPQFRAILGEVKLCEKMAQFDAKKFAESQPKKDTPRKEKGSRE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 57/226 (25%)
Thioredoxin_like 4..77 CDD:294274 25/70 (36%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/149 (19%)
Eef1gNP_001004223.1 GST_N_EF1Bgamma 4..82 CDD:239342 27/72 (38%)
maiA 5..187 CDD:273527 51/199 (26%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 29/143 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268 4/19 (21%)
EF1G 275..381 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.