DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Eef1e1

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001099576.1 Gene:Eef1e1 / 291057 RGDID:1311056 Length:174 Species:Rattus norvegicus


Alignment Length:166 Identity:38/166 - (22%)
Similarity:65/166 - (39%) Gaps:30/166 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QLSEEYLKKNP--------EHTVPTLE-DDGNYIWDSHAIIAYLVSKYADSDALYPRDLLQRAVV 96
            :|.|:.|...|        |..||.|: ::|..:.....|..:|| |.|:.:.|......::|:|
  Rat     8 RLLEKSLGLKPGNKYSAQGERQVPVLQTNNGPSLMGLSTIATHLV-KEANKEHLLGSTAEEKALV 71

  Fly    97 DQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERYDAIVEIYDFVETFLAGHDYIAGDQLTIAD 161
            .|.|.|....|..:..|..|:.| ...||                  ::|....|:||...|:||
  Rat    72 QQWLEFRITRVDGHSSKEDTQTL-LKDLN------------------SYLEDKVYLAGHNTTLAD 117

  Fly   162 FSLISSITSLVAFVEI-DRLKYPRIIEWVRRLEKLP 196
            ..|...:...:..:.: ::.||..:..|...::..|
  Rat   118 ILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 37/164 (23%)
Thioredoxin_like 4..77 CDD:294274 11/44 (25%)
GST_C_Delta_Epsilon 91..209 CDD:198287 23/107 (21%)
Eef1e1NP_001099576.1 GST_C_AIMP3 65..165 CDD:198338 23/108 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.