DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GSTT4

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:214 Identity:59/214 - (27%)
Similarity:92/214 - (42%) Gaps:41/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDS 68
            |.||....|.|.|||.:......:.:.|..|::......|:.|:..||...:|:|:|....:.:|
Human     3 LELYMDLLSAPCRAVYIFSKKHDIQFNFQFVDLLKGHHHSKGYIDINPLRKLPSLKDGKFILSES 67

  Fly    69 HAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAIT--KPLFFNGLNRIPK-- 129
            .||:.||..||:......|.|...||.||:.:.:: ...|...:|.|.  |.|       |||  
Human    68 AAILYYLCRKYSAPSHWCPPDPHARARVDEFVAWQ-HTAFQLPMKKIVWLKLL-------IPKIT 124

  Fly   130 ------ERYDAIVE-----IYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDR---- 179
                  |:.:..||     :..|.|.||....:|.|:|:::||         |||.||:.:    
Human   125 GEEVSAEKMEHAVEEVKNSLQLFEEYFLQDKMFITGNQISLAD---------LVAVVEMMQPMAA 180

  Fly   180 -----LKYPRIIEWVRRLE 193
                 |...::.||..::|
Human   181 NYNVFLNSSKLAEWRMQVE 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 59/214 (28%)
Thioredoxin_like 4..77 CDD:294274 22/72 (31%)
GST_C_Delta_Epsilon 91..209 CDD:198287 33/127 (26%)
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 22/74 (30%)