DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and gst2

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_588517.1 Gene:gst2 / 2539601 PomBaseID:SPCC965.07c Length:230 Species:Schizosaccharomyces pombe


Alignment Length:235 Identity:67/235 - (28%)
Similarity:96/235 - (40%) Gaps:39/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGN-- 63
            |...|||.....|....|.|.|..|.|.||.:..:....||..:|:|..||...||||.|..|  
pombe     1 MAHFTLYSHAGGPNPWKVVLALKELNLSYEQIFYDFQKGEQKCKEHLALNPNGRVPTLVDHKNND 65

  Fly    64 -YIWDSHAIIAYLVSKY-ADSDALYPRDLLQRAVVDQRLHFET---GVVFANGIKAITKPLFFNG 123
             .||:|.||:.||..|| .|.......|..:...:.|.|.|:.   ||::.       :..:||.
pombe    66 YTIWESDAILIYLADKYDTDRKISLSFDDPEYYKLIQYLFFQASGQGVIWG-------QAGWFNF 123

  Fly   124 LNRIP----KERY-DAIVEIYDFVETFLAGHDYIAGDQLTIADFSLIS--------------SIT 169
            .:..|    ..|| :.|..:...:|..|...||:..::.||||.|.|.              |..
pombe   124 FHHEPVVSAVTRYRNEIKRVLGVLEDILKDRDYLVANKYTIADLSFIPWNYNLGGLFGEGKFSFK 188

  Fly   170 SLVAFVEIDRLKYPRIIEWVRRL-----EKLPYYEEANAK 204
            ..|..::.:: ::|:...|.:||     .|..:.|.|.||
pombe   189 EEVPQLDFEK-EFPKAYAWNQRLLARPAVKATFEELAKAK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 62/222 (28%)
Thioredoxin_like 4..77 CDD:294274 30/75 (40%)
GST_C_Delta_Epsilon 91..209 CDD:198287 32/141 (23%)
gst2NP_588517.1 GST_N_Ure2p_like 4..84 CDD:239346 32/79 (41%)
GstA 5..226 CDD:223698 64/228 (28%)
GST_C_Ure2p 96..219 CDD:198326 28/130 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.