DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and AIMP3

DIOPT Version :10

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster


Alignment Length:92 Identity:24/92 - (26%)
Similarity:42/92 - (45%) Gaps:13/92 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLV-AFVEIDRLKYPRIIEWVRRL 192
            |::|.:...:.||.:.| |...|:.|..:|:||.::..:|..|| :...:|:..|..:..|...|
  Fly    87 KDKYVSKQLLADFNKLF-ASKSYLVGHFITLADLAVYYAIYDLVKSLSPVDKEVYLNLSRWFDHL 150

  Fly   193 EKLPYYEEANAKGARELETILKSTNFT 219
            :        |.....:.|.:|   |||
  Fly   151 Q--------NRADVHQGEPLL---NFT 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..210 CDD:440390 19/81 (23%)
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 22/90 (24%)

Return to query results.
Submit another query.