DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and eef1g

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_775370.1 Gene:eef1g / 195822 ZFINID:ZDB-GENE-020423-3 Length:442 Species:Danio rerio


Alignment Length:245 Identity:49/245 - (20%)
Similarity:89/245 - (36%) Gaps:83/245 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RAVKLTLAALQLPYEFVNVNIS--------GQEQLSEEYLKKNPEHTVPTLE-DDGNYIWDSHAI 71
            ||.|..:||   .|....:.|:        ||...|..:|...|...||..: |||..:::|:||
Zfish    14 RAFKAQIAA---QYSGARLKIASAPPAFTFGQTNRSPAFLGNFPLGKVPAYQGDDGFCLFESNAI 75

  Fly    72 IAYLVS------------------KYADSDALYPRDLLQRAVVDQRLHFETGVVFAN-GIKAITK 117
            ..||.:                  .:|||:.:.|               .:..||.. ||....|
Zfish    76 AHYLSNDVLRGSTPQASAQVLQWVSFADSEVIPP---------------ASAWVFPTLGIMQFNK 125

  Fly   118 PLFFNGLNRIPKERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSL------VAFVE 176
                    :..::..:.:..:...:...|....::.|:::::||.:::.|:..|      :||  
Zfish   126 --------QATEQAKEEVKRVLAVLNQHLNTRTFLVGERISLADITVVCSLLWLYKQVLELAF-- 180

  Fly   177 IDRLKYPRIIEW----------------VRRLEKLPYYEEANAKGARELE 210
              |..||.:..|                |:..||:..::   ||...|::
Zfish   181 --RQPYPNVTRWFVTCVNQPQFKTVLGEVKLCEKMAQFD---AKKFAEMQ 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 46/229 (20%)
Thioredoxin_like 4..77 CDD:294274 22/69 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 22/140 (16%)
eef1gNP_775370.1 GST_N_EF1Bgamma 4..82 CDD:239342 22/70 (31%)
maiA 5..201 CDD:273527 43/216 (20%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 23/148 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..273
EF1G 280..386 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.