DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and gst-21

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001256002.1 Gene:gst-21 / 191412 WormBaseID:WBGene00001769 Length:231 Species:Caenorhabditis elegans


Alignment Length:137 Identity:33/137 - (24%)
Similarity:50/137 - (36%) Gaps:25/137 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KKNPEHTVPTLEDDGNYIWDSHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGI 112
            ||.|....|.|:.|...|..|.||..||..::..:......:....:.:||...:.|..      
 Worm    65 KKAPFGKYPVLKIDDIEIAQSAAINRYLARQFGFAGKNPIEEAQADSYIDQCQEYNTSF------ 123

  Fly   113 KAITKPLFFNGLNRIPKERYDAI-VEIY-----DFVETF-------LAGHDYIAGDQLTIADFSL 164
                :...:..|...|:|....| .|:|     .|.|.|       .:|  ::.||.||.||..:
 Worm   124 ----RACMYATLQGKPEEEVQKIREEVYIPAQNKFYEIFSDILNRNKSG--FLVGDSLTWADLVI 182

  Fly   165 ISSITSL 171
            ...:.||
 Worm   183 ADHLYSL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 33/137 (24%)
Thioredoxin_like 4..77 CDD:294274 12/28 (43%)
GST_C_Delta_Epsilon 91..209 CDD:198287 21/94 (22%)
gst-21NP_001256002.1 GST_N_Sigma_like 16..94 CDD:239337 12/28 (43%)
PTZ00057 18..231 CDD:173353 33/137 (24%)
GST_C_Sigma_like 104..213 CDD:198301 21/98 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.