DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and gst-43

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:201 Identity:62/201 - (30%)
Similarity:92/201 - (45%) Gaps:31/201 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSE-EYLKKNPEHTVPTLEDDGNY 64
            |.|..||....|.....|::.||...:.||:..:::..:|..:. |::|.||...||||..:|..
 Worm     1 MAKPILYSYWRSSCAWRVRIALALKNIDYEYRPIDLFSEESKNNAEFVKHNPAKKVPTLVINGLS 65

  Fly    65 IWDSHAIIAYLVSKYADSDALYPRDL----LQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLN 125
            :.:|.|||.||...|.|...| |::|    ..||:.   ||          |.|..:||....::
 Worm    66 LTESLAIIEYLDEAYPDPPFL-PKELDKRSYSRAIA---LH----------IVASIQPLQAINIH 116

  Fly   126 RIPKERYDAIVEIY--DFV-------ETFLAGHD--YIAGDQLTIADFSLISSITSLVAFVEIDR 179
            ::..|:.....:.:  .||       |..|..|.  |..||||||||.:|.|.|.:...: ::|.
 Worm   117 KMLNEKEPGYGDFWCNHFVNKGFLALEELLKKHSGKYCVGDQLTIADINLPSIIYNAKIY-KVDM 180

  Fly   180 LKYPRI 185
            .|||.|
 Worm   181 SKYPTI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 60/198 (30%)
Thioredoxin_like 4..77 CDD:294274 24/73 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/106 (29%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 23/72 (32%)
maiA 5..211 CDD:273527 60/197 (30%)
GST_C_Zeta 90..207 CDD:198300 32/111 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163452
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.