DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and gst-24

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_496859.1 Gene:gst-24 / 185407 WormBaseID:WBGene00001772 Length:209 Species:Caenorhabditis elegans


Alignment Length:194 Identity:49/194 - (25%)
Similarity:80/194 - (41%) Gaps:39/194 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EFVNVNISGQEQLSEEY--LK-KNPEHTVPTLEDDGNYIWDSHAIIAYLVSKYADSDALYPRDLL 91
            ||.:|.|   |..:.|:  || |.|...:|.|..||..|..|.||:.||..|:..:......:..
 Worm    28 EFEDVRI---ENGTPEWGALKPKTPFGQLPFLSVDGFEIPQSAAILRYLAKKFGYAGKTSEEEAW 89

  Fly    92 QRAVVDQRLHFETGV---------VFANGIKAITKPL-------FFNGLNRIPKERYDAIVEIYD 140
            ..|:|||...|.|.:         ..|..|:.|.|.:       ||..||.|             
 Worm    90 VDAIVDQFKDFVTPLRQLIMAQRSGNAEEIERIQKEVFAPARDTFFKILNGI------------- 141

  Fly   141 FVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVR-RLEKLPYYEEANA 203
             :|...:|  ::.||.:|.||..:...:|::......|:....:.:..:| ::.::|..:|.|:
 Worm   142 -LEKSKSG--FLVGDGVTWADLVIADILTTMEMLGVFDKHGEEQKLAALREKVNEIPEIKEHNS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 46/185 (25%)
Thioredoxin_like 4..77 CDD:294274 20/49 (41%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/130 (22%)
gst-24NP_496859.1 GST_N_Sigma_like 4..75 CDD:239337 20/49 (41%)
PTZ00057 6..208 CDD:173353 49/194 (25%)
GST_C_Sigma_like 85..191 CDD:198301 25/121 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.