Sequence 1: | NP_611327.1 | Gene: | GstE5 / 37110 | FlyBaseID: | FBgn0063495 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509962.1 | Gene: | gst-42 / 183911 | WormBaseID: | WBGene00001790 | Length: | 214 | Species: | Caenorhabditis elegans |
Alignment Length: | 196 | Identity: | 60/196 - (30%) |
---|---|---|---|
Similarity: | 89/196 - (45%) | Gaps: | 23/196 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 VKLTLAALQLPYEFVNVNISGQEQLSEEYLKK-NPEHTVPTLEDDGNYIWDSHAIIAYLVSKYAD 81
Fly 82 SDALYPRDLLQRAVVDQRLHFET-GVVFANGIKAITKPLFFNGLNRIPKE-------RYDAIVEI 138
Fly 139 YDFVETFLAGHD--YIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVRRLEKLPYYEEA 201
Fly 202 N 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE5 | NP_611327.1 | GstA | 4..196 | CDD:223698 | 58/188 (31%) |
Thioredoxin_like | 4..77 | CDD:294274 | 24/59 (41%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 32/122 (26%) | ||
gst-42 | NP_509962.1 | GST_N_Zeta | 6..77 | CDD:239340 | 23/58 (40%) |
maiA | 7..211 | CDD:273527 | 60/196 (31%) | ||
GST_C_Zeta | 90..207 | CDD:198300 | 32/123 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |