DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and gst-42

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_509962.1 Gene:gst-42 / 183911 WormBaseID:WBGene00001790 Length:214 Species:Caenorhabditis elegans


Alignment Length:196 Identity:60/196 - (30%)
Similarity:89/196 - (45%) Gaps:23/196 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VKLTLAALQLPYEFVNVNISGQEQLSEEYLKK-NPEHTVPTLEDDGNYIWDSHAIIAYLVSKYAD 81
            |::.||...:.||:..|::..:|..|:  ||: ||...|||...||..|.:|.|||.||...:.|
 Worm    20 VRIALALKNVDYEYKTVDLLSEEAKSK--LKEINPAAKVPTFVVDGQVITESLAIIEYLEETHPD 82

  Fly    82 SDALYPRDLLQRAVVDQRLHFET-GVVFANGIKAITKPLFFNGLNRIPKE-------RYDAIVEI 138
            . .|.|:|.::||      |... .::.|:||:.:........||:  ||       ....:||.
 Worm    83 V-PLLPKDPIKRA------HARAISLLVASGIQPLHNLKVLQLLNK--KEAGFGGQFAKQFVVEG 138

  Fly   139 YDFVETFLAGHD--YIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVRRLEKLPYYEEA 201
            ...:|..|..|.  |..||.:||||.|:...|.|...| .:|...||.:......|..:|.:..|
 Worm   139 LTALEILLKQHSGKYAVGDDVTIADLSIPPLIYSANRF-NLDLSPYPTVNRINETLADIPAFIAA 202

  Fly   202 N 202
            :
 Worm   203 H 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 58/188 (31%)
Thioredoxin_like 4..77 CDD:294274 24/59 (41%)
GST_C_Delta_Epsilon 91..209 CDD:198287 32/122 (26%)
gst-42NP_509962.1 GST_N_Zeta 6..77 CDD:239340 23/58 (40%)
maiA 7..211 CDD:273527 60/196 (31%)
GST_C_Zeta 90..207 CDD:198300 32/123 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.