DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and exl-1

DIOPT Version :10

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_497000.1 Gene:exl-1 / 175100 WormBaseID:WBGene00001371 Length:238 Species:Caenorhabditis elegans


Alignment Length:106 Identity:25/106 - (23%)
Similarity:34/106 - (32%) Gaps:23/106 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGVNPSPPVRAVKLTLAALQLPYEFVNVNI----------SGQEQLSE---------EYLKKNP 51
            ||.....|.::....|....:...||.|..:          ||:.|..|         ||||  |
 Worm    31 LYHAKHDPTMKFDVKTTNVNKTSQEFKNTGLRRMPGISAEESGETQTFETEDDILDFLEYLK--P 93

  Fly    52 EHTVPTLEDDGNYIWDSHAIIAYLVSKYADSDALYPRDLLQ 92
            |....  |:..|...|.....|..|......|..:..:||:
 Worm    94 ERGDD--EEAENATCDLFRQFARFVKDVEHRDTAFNTELLR 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..210 CDD:440390 25/106 (24%)
exl-1NP_497000.1 GST_C_family 98..210 CDD:470672 8/37 (22%)

Return to query results.
Submit another query.