DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Gsto1

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_034492.1 Gene:Gsto1 / 14873 MGIID:1342273 Length:240 Species:Mus musculus


Alignment Length:213 Identity:47/213 - (22%)
Similarity:92/213 - (43%) Gaps:19/213 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLED-DGNYIW 66
            ::.:|.:...|..:...:.|.|..:.:|.:|:|:..:   .|.:.:|||...||.||: .|:.:.
Mouse    23 QIRVYSMRFCPFAQRTLMVLKAKGIRHEVININLKNK---PEWFFEKNPLGLVPVLENSQGHLVT 84

  Fly    67 DSHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFET----GVVFANGIKAITKPLFFNGLNRI 127
            :|.....||...|.:. .|:|.|..::|  .|::..|:    ..:.|:.:::..|....| |...
Mouse    85 ESVITCEYLDEAYPEK-KLFPDDPYKKA--RQKMTLESFSKVPPLIASFVRSKRKEDSPN-LREA 145

  Fly   128 PKERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVRRL 192
            .:..:..:.|..|..::||.|......|.||...|..:.::..........:||.     |:..:
Mouse   146 LENEFKKLEEGMDNYKSFLGGDSPSMVDYLTWPWFQRLEALELKECLAHTPKLKL-----WMAAM 205

  Fly   193 EKLPY--YEEANAKGARE 208
            ::.|.  ..:.:||..||
Mouse   206 QQDPVASSHKIDAKTYRE 223

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 42/196 (21%)
Thioredoxin_like 4..77 CDD:294274 19/73 (26%)
GST_C_Delta_Epsilon 91..209 CDD:198287 24/124 (19%)
Gsto1NP_034492.1 GST_N_Omega 5..94 CDD:239353 18/73 (25%)
GstA 26..224 CDD:223698 47/210 (22%)