DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Gstt2

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus


Alignment Length:213 Identity:59/213 - (27%)
Similarity:99/213 - (46%) Gaps:33/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIW-- 66
            |.||....|.|.|||.:......:|::...|:|...:.:||::.:.|..:.||.|: ||:::.  
Mouse     3 LELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLK-DGSFVLTE 66

  Fly    67 ------DSHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFAN-GIKAITK---PLFF 121
                  .|.||:.||.|||..:|..||.||..||.|.:.|.:....:... |:...||   ||. 
Mouse    67 SPSSMIPSTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLI- 130

  Fly   122 NGLNRIPKERYD-----AIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLK 181
             |: ::|:|:.:     .::.:....:.||....::.|.|:|:||...:..:...||      |.
Mouse   131 -GV-QVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADLMSLEELMQPVA------LG 187

  Fly   182 Y------PRIIEWVRRLE 193
            |      |::..|..|:|
Mouse   188 YNLFEGRPQLTAWRERVE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 59/213 (28%)
Thioredoxin_like 4..77 CDD:294274 24/80 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 27/118 (23%)
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 25/82 (30%)
GST_C_Theta 98..223 CDD:198292 27/117 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844541
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.