DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Gstt1

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus


Alignment Length:232 Identity:64/232 - (27%)
Similarity:102/232 - (43%) Gaps:39/232 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDS 68
            |.||....|.|.||:.:......:|::...|.:...|.||:.:.:.||...||.:.|.|..:.:|
Mouse     3 LELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCES 67

  Fly    69 HAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKA----ITKPLFFNGLNRIPK 129
            .||:.||..||...|..||:||..||.||:.|.::...:..:.::|    :..|:|..  .:||.
Mouse    68 VAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMFPVFLG--EQIPP 130

  Fly   130 ERYDAI-----VEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDR---------L 180
            |...|.     |.:....:.||...|::.|..:::||         |||..|:..         .
Mouse   131 ETLAATLAELDVNLQVLEDKFLQDKDFLVGPHISLAD---------LVAITELMHPVGGGCPVFE 186

  Fly   181 KYPRIIEWVRRLEKL---PYYEEANAKGARELETILK 214
            .:||:..|.:|:|..   ..:.||:       |.|||
Mouse   187 GHPRLAAWYQRVEAAVGKDLFREAH-------EVILK 216

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 58/212 (27%)
Thioredoxin_like 4..77 CDD:294274 23/72 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 30/138 (22%)
Gstt1NP_032211.3 GstA 3..212 CDD:223698 60/226 (27%)
GST_N_Theta 3..78 CDD:239348 23/74 (31%)