DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GSTO2

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:200 Identity:42/200 - (21%)
Similarity:81/200 - (40%) Gaps:25/200 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLE-DDGNYIWD 67
            :.:|.:...|.....:|.|.|..:.:|.||:|:..:   .|.|..|:|...:|.|| .....|::
Human    24 IRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNK---PEWYYTKHPFGHIPVLETSQCQLIYE 85

  Fly    68 SHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFF--------NGL 124
            |.....||...| ....|:|.|..:||  .|::..|   :|.. :..:||....        ..|
Human    86 SVIACEYLDDAY-PGRKLFPYDPYERA--RQKMLLE---LFCK-VPHLTKECLVALRCGRECTNL 143

  Fly   125 NRIPKERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKY-PRIIEW 188
            ....::.:..:.||.::..|     .:..|..:::.|:.|......|..:..:|.:.: |.:..|
Human   144 KAALRQEFSNLEEILEYQNT-----TFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLW 203

  Fly   189 VRRLE 193
            :..::
Human   204 ISAMK 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 42/199 (21%)
Thioredoxin_like 4..77 CDD:294274 20/73 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 18/111 (16%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 19/72 (26%)