Protein Alignment GstE5 and CLIC2

DIOPT Version :9

• Sequence 1: NP_611327.1
• Gene: GstE5 / 37110
• FlyBaseID: FBgn0063495
• Length: 222
• Species: Drosophila melanogaster
• Sequence 2: NP_001280.3
• Gene: CLIC2 / 1193
• HGNCID: 2063
• Length: 247
• Species: Homo sapiens
• Alignment Length: 32
• Identity: 11/32 - (34%)
• Similarity: 19/32 - (59%)
• Gaps: 4/32 - (12%)

  Fly   151 YIAGDQLTIADFSLISSITSLVAFVEIDRLKY 182
            ::.|||||:||.||:..:.    .:::...||
Human   173 FLDGDQLTLADCSLLPKLN----IIKVAAKKY 200

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
GstE5	NP_611327.1	GstA	4..196	CDD:223698	11/32 (34%)
		Thioredoxin_like	4..77	CDD:294274
		GST_C_Delta_Epsilon	91..209	CDD:198287	11/32 (34%)
CLIC2	NP_001280.3	Required for insertion into the membrane. /evidence=ECO:0000250	1..96
		N-terminal	1..94
		O-ClC	12..245	CDD:129941	11/32 (34%)
		Joint loop	95..106
		C-terminal	107..247		11/32 (34%)
		Foot loop	151..171

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165154409
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.840