DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and CLIC1

DIOPT Version :10

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001279.2 Gene:CLIC1 / 1192 HGNCID:2062 Length:241 Species:Homo sapiens


Alignment Length:206 Identity:43/206 - (20%)
Similarity:68/206 - (33%) Gaps:58/206 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLPYEFVNVNISGQEQLSEEYLKK-------------NPEHTVPTLEDDGNYIWDSHAIIAYLV- 76
            |||:......:.......||:|:.             |||.....|:....:       .||:. 
Human    63 QLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKF-------SAYIKN 120

  Fly    77 SKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERYDAIVEIYDF 141
            |..|.:|.|....|....|:|..|               |.||        |:|..:...|    
Human   121 SNPALNDNLEKGLLKALKVLDNYL---------------TSPL--------PEEVDETSAE---- 158

  Fly   142 VETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKY-----PRIIEWVRRLEKLPYYEEA 201
             :..::...::.|::||:||.:|:..:    ..|::...||     |.....|.|.....|..|.
Human   159 -DEGVSQRKFLDGNELTLADCNLLPKL----HIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREE 218

  Fly   202 NAKGARELETI 212
            .|....:.|.|
Human   219 FASTCPDDEEI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..210 CDD:440390 41/202 (20%)
CLIC1NP_001279.2 Required for insertion into the membrane 2..90 6/26 (23%)
O-ClC 6..241 CDD:129941 43/206 (21%)
G-site. /evidence=ECO:0000305|PubMed:25581026 24..27
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.