DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Gsto1

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001007603.1 Gene:Gsto1 / 114846 RGDID:70952 Length:241 Species:Rattus norvegicus


Alignment Length:206 Identity:48/206 - (23%)
Similarity:83/206 - (40%) Gaps:46/206 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLED-DGNYIW 66
            ::.:|.:...|..:...:.|.|..:.:|.:|:|:..:   .|.:.:|||...||.||: .|:.|.
  Rat    23 QIRVYSMRFCPFAQRTLMVLKAKGIRHEIININLKNK---PEWFFEKNPFGLVPVLENTQGHLIT 84

  Fly    67 DSHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFN--------G 123
            :|.....||...|.:. .|:|.|..::|.  |::.||   :|:.....:|.  |..        |
  Rat    85 ESVITCEYLDEAYPEK-KLFPDDPYEKAC--QKMTFE---LFSKVPSLVTS--FIRAKRKEDHPG 141

  Fly   124 LNRIPKERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEW 188
            :....|:.:..:.|......|...|     |:.|::                 ||.|.:|    |
  Rat   142 IKEELKKEFSKLEEAMAKKRTAFFG-----GNSLSM-----------------IDYLIWP----W 180

  Fly   189 VRRLEKLPYYE 199
            .:|||.|...|
  Rat   181 FQRLEALELNE 191

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 46/200 (23%)
Thioredoxin_like 4..77 CDD:294274 20/73 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 24/117 (21%)
Gsto1NP_001007603.1 GST_N_Omega 5..94 CDD:239353 19/73 (26%)
GstA 26..214 CDD:223698 48/203 (24%)