Sequence 1: | NP_611327.1 | Gene: | GstE5 / 37110 | FlyBaseID: | FBgn0063495 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_254279.1 | Gene: | Clic1 / 114584 | MGIID: | 2148924 | Length: | 241 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 43/206 - (20%) |
---|---|---|---|
Similarity: | 68/206 - (33%) | Gaps: | 58/206 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 QLPYEFVNVNISGQEQLSEEYLKK-------------NPEHTVPTLEDDGNYIWDSHAIIAYLV- 76
Fly 77 SKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERYDAIVEIYDF 141
Fly 142 VETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKY-----PRIIEWVRRLEKLPYYEEA 201
Fly 202 NAKGARELETI 212 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE5 | NP_611327.1 | GstA | 4..196 | CDD:223698 | 38/188 (20%) |
Thioredoxin_like | 4..77 | CDD:294274 | 12/64 (19%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 24/122 (20%) | ||
Clic1 | NP_254279.1 | Required for insertion into the membrane. /evidence=ECO:0000250 | 2..90 | 6/26 (23%) | |
O-ClC | 6..241 | CDD:129941 | 43/206 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844825 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |