DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Clic1

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_254279.1 Gene:Clic1 / 114584 MGIID:2148924 Length:241 Species:Mus musculus


Alignment Length:206 Identity:43/206 - (20%)
Similarity:68/206 - (33%) Gaps:58/206 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLPYEFVNVNISGQEQLSEEYLKK-------------NPEHTVPTLEDDGNYIWDSHAIIAYLV- 76
            |||:......:.......||:|:.             |||.....|:....:       .||:. 
Mouse    63 QLPFLLYGTEVHTDTNKIEEFLEAMLCPPRYPKLAALNPESNTSGLDIFAKF-------SAYIKN 120

  Fly    77 SKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERYDAIVEIYDF 141
            |..|.:|.|....|....|:|..|               |.||        |:|..:...|    
Mouse   121 SNPALNDNLEKGLLKALKVLDNYL---------------TSPL--------PEEVDETSAE---- 158

  Fly   142 VETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKY-----PRIIEWVRRLEKLPYYEEA 201
             :..::...::.|::||:||.:|:..:    ..|::...||     |.....|.|.....|..|.
Mouse   159 -DEGISQRKFLDGNELTLADCNLLPKL----HIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREE 218

  Fly   202 NAKGARELETI 212
            .|....:.|.|
Mouse   219 FASTCPDDEEI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 38/188 (20%)
Thioredoxin_like 4..77 CDD:294274 12/64 (19%)
GST_C_Delta_Epsilon 91..209 CDD:198287 24/122 (20%)
Clic1NP_254279.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..90 6/26 (23%)
O-ClC 6..241 CDD:129941 43/206 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844825
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.