DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and LOC100911464

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_038967329.1 Gene:LOC100911464 / 100911464 RGDID:6492721 Length:249 Species:Rattus norvegicus


Alignment Length:191 Identity:42/191 - (21%)
Similarity:72/191 - (37%) Gaps:74/191 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 HT-----VPTLEDDGNYIWDSHAIIAYLVSKYADSDALYPRDLLQRAVVD------QRLHFE--- 103
            ||     :|..||....::.|.||:.::    ..|..||.:...:.|:||      :.||:.   
  Rat    95 HTCLYGQLPKFEDGDLTLYQSSAILRHV----GHSFGLYGKGQREAALVDMVNDGVEDLHYRYVT 155

  Fly   104 -TGVVFANG----IKAI---TKPLFFNGLNRIPKERYDAIVEIYDFVETFLA----GHDYIAGDQ 156
             ...::.||    :||:   .||.                       ||.|:    |..:|.|||
  Rat   156 LIYTIYENGKDDYMKALPGHLKPF-----------------------ETLLSQNQEGKAFIVGDQ 197

  Fly   157 LTIADFSLISSITSLVAFVEIDRLKYPRIIEWVRRLEKLPYYEEANAKGARELETILKSTN 217
            ::.|:::|:..:  ||.|        |.:..:|..|...|           :::..|.|:|
  Rat   198 ISFANYNLLDLL--LVHF--------PLLAAYVVHLSAQP-----------KIKAFLSSSN 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 38/168 (23%)
Thioredoxin_like 4..77 CDD:294274 8/28 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/138 (20%)
LOC100911464XP_038967329.1 Thioredoxin_like <96..123 CDD:412351 7/30 (23%)
GST_C_family 133..249 CDD:413470 31/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.