DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and gstz1

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_002938913.1 Gene:gstz1 / 100145591 XenbaseID:XB-GENE-978910 Length:216 Species:Xenopus tropicalis


Alignment Length:197 Identity:62/197 - (31%)
Similarity:90/197 - (45%) Gaps:28/197 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGVNPSPPVRAVKLTLAALQLPY--EFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYI 65
            |..|||...|.....|::.||...:.|  :.:|:...|..|||.||.:.||...||.|..||..:
 Frog     6 KPLLYGYFRSSCSWRVRIALAFKGIEYDQQVINLVKDGGMQLSNEYKQVNPMQQVPALCIDGVTL 70

  Fly    66 WDSHAIIAYLVSKYADSDALYPRDLLQRAVV----DQRLHFETGVVFANGIKAITKPLFFNGLNR 126
            ..|.|||.|| .:...:..|.|||..:||.|    ||         .|:||:.:.....   |.:
 Frog    71 SQSLAIIEYL-EETRPNPPLLPRDPKKRAQVRMISDQ---------IASGIQPLQNLCV---LQK 122

  Fly   127 IPKERYD----AIVEIYDFVETFL---AGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPR 184
            |.:.:.:    .|...:..:|..|   ||. |..||::||||..|:..:.:.|.| ::|...||.
 Frog   123 IGETKLEWAKHFITRGFQALEKLLQTTAGR-YCVGDEVTIADLCLVPQVANAVRF-KVDLAPYPT 185

  Fly   185 II 186
            |:
 Frog   186 IV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 61/196 (31%)
Thioredoxin_like 4..77 CDD:294274 28/74 (38%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/107 (27%)
gstz1XP_002938913.1 maiA 8..211 CDD:273527 61/195 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.