DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and Clic5

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_446055.1 Gene:Clic5 / 94272 RGDID:620659 Length:251 Species:Rattus norvegicus


Alignment Length:222 Identity:50/222 - (22%)
Similarity:79/222 - (35%) Gaps:56/222 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KISLY---GLDAS-----PPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQ 59
            :|.|:   |:|..     |.::...:.|....:.|....|:|..|   ..|.....|....|.|.
  Rat    15 EIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRK---PADLHNLAPGTHPPFLT 76

  Fly    60 DDDACIWDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGV----IFE--SALRRLTRP 118
            .:.....|.:.|..:|.|...|  |.||| |..|       |.||..    ||.  ||..:.|:.
  Rat    77 FNGDVKTDVNKIEEFLEETLTP--EKYPK-LAAR-------HRESNTAGIDIFSKFSAYIKNTKQ 131

  Fly   119 VLFFGEPTLPRNQVDHILQVYDFVETFLDD--------------HDFVAGDQLTIADFSIVSTIT 169
            .   ....|.|.....:.::.|::.|.|.:              ..|:.||:||:||.:::..:.
  Rat   132 Q---NNAALERGLTKALRKLDDYLNTPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKLH 193

  Fly   170 SIGVFLELDPAKYPKIAAWLERLKELP 196
            .:            ||.|...|..::|
  Rat   194 VV------------KIVAKKYRNYDIP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 17/80 (21%)
GstA 6..196 CDD:223698 48/217 (22%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/126 (21%)
Clic5NP_446055.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..98 18/85 (21%)
O-ClC 14..249 CDD:129941 50/222 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348299
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.