DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and CAM1

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:191 Identity:44/191 - (23%)
Similarity:81/191 - (42%) Gaps:20/191 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKALDLPFEFVFVNLFEKENFSEDFS-KKNPQHTVPLLQDDDACIWDSHAIMAYLVEKYAPSDEL 85
            :|||.|..:.|..:. ..|.|:.||. ||.|....|    ....:.::.||..||| |.:..|::
Yeast    21 VKALKLDVKVVTPDA-AAEQFARDFPLKKVPAFVGP----KGYKLTEAMAINYYLV-KLSQDDKM 79

  Fly    86 YPKDLLQRAKVD-----QLMHFESGVIFESALRRLTRPVLFFGEPTLPRNQVDHIL----QVYDF 141
              |..|..|..|     |::.::|....:..::.....|...|.....:..||..:    ::.|.
Yeast    80 --KTQLLGADDDLNAQAQIIRWQSLANSDLCIQIANTIVPLKGGAPYNKKSVDSAMDAVDKIVDI 142

  Fly   142 VETFLDDHDFVAGDQLTIADFSIVSTITSI--GVFLELDPAKYPKIAAWLERLKELPYYEE 200
            .|..|.::.::|.:.:::||....|..|..  .:|.....|::|.|..|...::..|:.::
Yeast   143 FENRLKNYTYLATENISLADLVAASIFTRYFESLFGTEWRAQHPAIVRWFNTVRASPFLKD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 17/55 (31%)
GstA 6..196 CDD:223698 43/185 (23%)
GST_C_Delta_Epsilon 91..209 CDD:198287 23/121 (19%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342 18/57 (32%)
GST_C_EF1Bgamma_like 92..214 CDD:198290 20/112 (18%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345091
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.