DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and URE2

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:250 Identity:53/250 - (21%)
Similarity:96/250 - (38%) Gaps:77/250 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQD---DDACIW 66
            :|:...::|......:.|..|...:..:|::....|:.:.:|...||...||.|.|   |:..||
Yeast   115 TLFSHRSAPNGFKVAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIW 179

  Fly    67 DSHAIMAYLVEKY---APSDELYPKDLLQRAKVD---------------QLMHFE--SGVIFESA 111
            :|.||:.:||.||   ..:..|:..||..:::::               |.:||.  ......||
Yeast   180 ESGAILLHLVNKYYKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFRYFHSQKIASA 244

  Fly   112 LRRLTRPVLFFGEPTLPRNQVDHILQVYDFVE--------------------------------T 144
            :.|.|                |.:.:||..||                                .
Yeast   245 VERYT----------------DEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQSR 293

  Fly   145 FLDDHDFVAGDQLTIADFSIV---STITSIGVFLELDPAKYPKIAAWLERLKELP 196
            |.|...::.||:|||||.:.|   :.:..||:.::::   :|::..|.:.:...|
Yeast   294 FFDYPVWLVGDKLTIADLAFVPWNNVVDRIGINIKIE---FPEVYKWTKHMMRRP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 20/74 (27%)
GstA 6..196 CDD:223698 52/247 (21%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/157 (17%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 23/78 (29%)
GST_C_Ure2p 208..350 CDD:198326 26/156 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.