DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and GTT1

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:52/233 - (22%)
Similarity:95/233 - (40%) Gaps:38/233 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKE-NF--SEDFSKKNPQHTVPLLQDDD--- 62
            |.::.||.|...| .|..|..|:|.:|.|   .:::: ||  ..:..|.:|....|||:..|   
Yeast     6 IKVHWLDHSRAFR-LLWLLDHLNLEYEIV---PYKRDANFRAPPELKKIHPLGRSPLLEVQDRET 66

  Fly    63 ---ACIWDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESG-----VIFESALRRLTRPV 119
               ..:.:|..|..|:::.:..|..|..:|.....:::..:.:..|     ::.|..|.::....
Yeast    67 GKKKILAESGFIFQYVLQHFDHSHVLMSEDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDSG 131

  Fly   120 LFFGEPTLPRNQVDHILQVY---------DFVETFLD-DHDFVAGDQLTIADFSIVSTITSIGVF 174
            :.|....|.|...|.|.|.|         ||||..:. ::.::...:|:.||.     :.|..:.
Yeast   132 MPFPISYLARKVADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADI-----LMSFPLQ 191

  Fly   175 LELD-----PAKYPKIAAWLERLKELPYYEEANGKGAA 207
            :..:     |..||.|:.||:.:.....|..:..|..|
Yeast   192 MAFERKFAAPEDYPAISKWLKTITSEESYAASKEKARA 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 22/81 (27%)
GstA 6..196 CDD:223698 48/218 (22%)
GST_C_Delta_Epsilon 91..209 CDD:198287 27/137 (20%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 22/84 (26%)
GST_C_GTT1_like 93..218 CDD:198298 25/129 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.