DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and YGR201C

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:184 Identity:48/184 - (26%)
Similarity:80/184 - (43%) Gaps:38/184 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LFEKENFSEDFS-KKNPQHTVPLLQDDDACIWDSHAIMAYLV----EKYAPSDELYPK-DLLQRA 94
            |:|:|     |. :|.|....|   .|:..:.::.||..||:    :|.|....|.|: |...||
Yeast    43 LYERE-----FPLRKYPTFVGP---HDEWTLTEAMAIDYYLIHLSSDKEAVRQLLGPEGDFKTRA 99

  Fly    95 KVDQLMHFESGVIFESALRRLTRPVLF--FG-------EPTLPRNQVDHILQVYD---FVETFL- 146
               .::.:||  :..|........|.|  .|       |....|..||.|:.:|:   ..:.:| 
Yeast   100 ---DILRWES--LSNSDFLNEVCEVFFPLIGVKPYNATEFKAARENVDTIVSLYEKRLKKQQYLV 159

  Fly   147 -DDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKELPYYE 199
             |||:.:| |.::.|.||    :..|..|.|...:|:|::..|..|:.:..::|
Yeast   160 CDDHETLA-DLISAAAFS----LGFISFFDETWRSKHPEVTRWFNRVIKSRFFE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 12/45 (27%)
GstA 6..196 CDD:223698 47/179 (26%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/123 (25%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 12/42 (29%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 31/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345078
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.