DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and GSTF6

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001184893.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:216 Identity:58/216 - (26%)
Similarity:97/216 - (44%) Gaps:34/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACI 65
            |..|.::|..||..||..|:.|...::.||||.|.|.:.|:..|.|..:||...||..:|.|..|
plant     1 MAGIKVFGHPASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKI 65

  Fly    66 WDSHAIMAYLVEKYAPSDELYPKDLLQRAK--------VDQLMH-FE---SGVIFESALRRLTRP 118
            ::|.||..|:..::  ||:  ..:||...|        ::...| |:   |.:::|..|:.|   
plant    66 FESRAITQYIAHEF--SDK--GNNLLSTGKDMAIIAMGIEIESHEFDPVGSKLVWEQVLKPL--- 123

  Fly   119 VLFFG---EPTLPRNQVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPA 180
               :|   :.|:...:...:.:|.|..|..|.:..::|.|..|:.|...:..|.    :|...|.
plant   124 ---YGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDHFTLVDLHTIPVIQ----YLLGTPT 181

  Fly   181 K-----YPKIAAWLERLKELP 196
            |     .|.::||:..:...|
plant   182 KKLFDERPHVSAWVADITSRP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 28/72 (39%)
GstA 6..196 CDD:223698 55/209 (26%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/126 (21%)
GSTF6NP_001184893.1 GST_N_Phi 4..77 CDD:239351 28/72 (39%)
GST_C_Phi 91..208 CDD:198296 25/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.