DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and GSTF4

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:207 Identity:49/207 - (23%)
Similarity:86/207 - (41%) Gaps:32/207 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDSHA 70
            ::|...|..||..|..|....|.:|.:.|.|...|:.:|.|...||...||:.:|....:::|.|
plant    39 VHGDPFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESRA 103

  Fly    71 IMAYLVEKYAPSDE----LYPKDLLQRAKVDQLMHFESGVIFESALRRLT-----RPVLFFGEPT 126
            |..|:.  |..|..    |..:.....|.:...|..|:.. |:....:||     :|:  :|..|
plant   104 ITQYIA--YVHSSRGTQLLNLRSHETMATLTMWMEIEAHQ-FDPPASKLTWEQVIKPI--YGLET 163

  Fly   127 ----LPRNQ--VDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPA----- 180
                :..|:  ::.:|.:|   |..|::..|:|.:..|:.|...:..|.    :|...|.     
plant   164 DQTIVKENEAILEKVLNIY---EKRLEESRFLACNSFTLVDLHHLPNIQ----YLLGTPTKKLFE 221

  Fly   181 KYPKIAAWLERL 192
            |..|:..|::.:
plant   222 KRSKVRKWVDEI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 22/70 (31%)
GstA 6..196 CDD:223698 49/207 (24%)
GST_C_Delta_Epsilon 91..209 CDD:198287 24/118 (20%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 22/69 (32%)
GST_C_Phi 126..243 CDD:198296 24/118 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.