DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and GSTF11

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 / 821227 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana


Alignment Length:178 Identity:53/178 - (29%)
Similarity:82/178 - (46%) Gaps:30/178 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISLYG-LDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQH-------TVPLLQD 60
            :.:|| :.|:.|.|..|..|:. |:.||.:.|:|       :...:|.|||       .||.::|
plant     3 VKVYGQIKAANPQRVLLCFLEK-DIEFEVIHVDL-------DKLEQKKPQHLLRQPFGQVPAIED 59

  Fly    61 DDACIWDSHAIMAYLVEKYA-PSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGE 124
            ....:::|.||..|...||| ...:|..|.|..||.|||.:..|:...:..|| .|...|:|..:
plant    60 GYLKLFESRAIARYYATKYADQGTDLLGKTLEGRAIVDQWVEVENNYFYAVAL-PLVMNVVFKPK 123

  Fly   125 PTLP---------RNQVDHILQVYDFVETFLDDHDFVAGDQLTIADFS 163
            ...|         :.:.|.:|.||   |..|..:.::.||:.|:||.|
plant   124 SGKPCDVALVEELKVKFDKVLDVY---ENRLATNRYLGGDEFTLADLS 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 23/80 (29%)
GstA 6..196 CDD:223698 53/176 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 24/82 (29%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 53/178 (30%)
GST_N_Phi 2..77 CDD:239351 23/81 (28%)
GST_C_Phi 91..209 CDD:198296 24/82 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.