DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and GSTF8

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001323480.1 Gene:GSTF8 / 819386 AraportID:AT2G47730 Length:263 Species:Arabidopsis thaliana


Alignment Length:212 Identity:59/212 - (27%)
Similarity:95/212 - (44%) Gaps:24/212 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACI 65
            |..|.::|:..|..|...|.||...||.||.:.|::....:..|.....||...:|.|:|.|..:
plant    49 MASIKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGDLTL 113

  Fly    66 WDSHAIMAYLVEKYAPSDE-LYPKDLLQ-RAKVDQLMHFESGVIFESALRRLTRPVLF---FGEP 125
            ::|.||..||.|:|:...| |..:|..: :|..:..:..| |..|:....:|....:|   ||..
plant   114 FESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVE-GQQFDPNASKLAFERVFKGMFGMT 177

  Fly   126 TLP------RNQVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTI-----TSIGVFLELDP 179
            |.|      ..::..:|.||   |..|...:|:|||..|:||...:..|     |...|..:   
plant   178 TDPAAVQELEGKLQKVLDVY---EARLAKSEFLAGDSFTLADLHHLPAIHYLLGTDSKVLFD--- 236

  Fly   180 AKYPKIAAWLERLKELP 196
             ..||::.|::::...|
plant   237 -SRPKVSEWIKKISARP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 24/72 (33%)
GstA 6..196 CDD:223698 56/205 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/121 (24%)
GSTF8NP_001323480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.