DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and VARS1

DIOPT Version :10

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_005249419.1 Gene:VARS1 / 7407 HGNCID:12651 Length:1265 Species:Homo sapiens


Alignment Length:65 Identity:14/65 - (21%)
Similarity:30/65 - (46%) Gaps:2/65 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 VETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAK--YPKIAAWLERLKELPYYEEANGK 204
            :|.:|..|.::||:..|:||.:.|:.:.....::...||:  :..:..|.......|.:....|:
Human   142 LEEWLRLHTYLAGEAPTLADLAAVTALLLPFRYVLDPPARRIWNNVTRWFVTCVRQPEFRAVLGE 206

  Fly   205  204
            Human   207  206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GstA 6..209 CDD:440390 14/65 (22%)
VARS1XP_005249419.1 GST_C_ValRS_N 92..213 CDD:198327 14/65 (22%)
PTZ00419 283..1265 CDD:240411
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.