DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and Gsto2

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_080895.2 Gene:Gsto2 / 68214 MGIID:1915464 Length:248 Species:Mus musculus


Alignment Length:217 Identity:43/217 - (19%)
Similarity:86/217 - (39%) Gaps:49/217 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDA-CI 65
            |.|.:|.:...|.:....|.|||..:..|.:.:||..|.::   :..|:|...:|:|::... .:
Mouse    22 GVIRIYSMRFCPYSHRARLVLKAKGIRHEVININLKSKPDW---YYTKHPFGQIPVLENSQCQLV 83

  Fly    66 WDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLP-- 128
            ::|.....||.:.| |..:|:|.|..:||:...|:.                  ||...|.|.  
Mouse    84 YESVIACEYLDDVY-PGRKLFPYDPYERARQKMLLE------------------LFCKVPPLSKE 129

  Fly   129 ------------------RNQVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFL 175
                              |.::.::.::.::..|     .|..||.:::.|:.:......:.|:.
Mouse   130 CLIALRCGRDCTDLKVALRQELCNMEEILEYQNT-----TFFGGDCISMIDYLVWPWFERLDVYG 189

  Fly   176 ELDPAKY-PKIAAWLERLKELP 196
            ..|...: |.:..|:..:|:.|
Mouse   190 LADCVNHTPMLRLWIASMKQDP 211

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 18/73 (25%)
GstA 6..196 CDD:223698 40/211 (19%)
GST_C_Delta_Epsilon 91..209 CDD:198287 19/127 (15%)
Gsto2NP_080895.2 GST_N_Omega 6..94 CDD:239353 18/74 (24%)