DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and Eef1e1

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_079656.1 Gene:Eef1e1 / 66143 MGIID:1913393 Length:174 Species:Mus musculus


Alignment Length:167 Identity:36/167 - (21%)
Similarity:69/167 - (41%) Gaps:24/167 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VNLFEKENFSEDFSKKNPQ--HTVPLLQDDDA-CIWDSHAIMAYLVEKYAPSDELYPKDLLQRAK 95
            :.|.||....:..:|.:.|  ..:|:||.::. .:.....|..:|| |.|..:.|......::|.
Mouse     7 LRLLEKSLGLKPGNKYSAQGERQIPVLQTNNGPSLMGLSTIATHLV-KQASKEHLLGSTAEEKAM 70

  Fly    96 VDQLMHFESGVIFESALRRLTRPVLFFGEPTLPRNQVDHILQVYDFVETFLDDHDFVAGDQLTIA 160
            |.|.:.|           |:||   ..|..:....|.     :...:.::|:|..::||..:|:|
Mouse    71 VQQWLEF-----------RVTR---VDGHSSKEDTQT-----LLKDLNSYLEDKVYLAGHNITLA 116

  Fly   161 DFSIVSTITSIGVFLEL-DPAKYPKIAAWLERLKELP 196
            |..:...:....|.|.: :..||..::.|...::..|
Mouse   117 DILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 10/45 (22%)
GstA 6..196 CDD:223698 35/165 (21%)
GST_C_Delta_Epsilon 91..209 CDD:198287 22/107 (21%)
Eef1e1NP_079656.1 N-terminal. /evidence=ECO:0000250 2..56 12/49 (24%)
Linker. /evidence=ECO:0000250 57..63 1/5 (20%)
C-terminal. /evidence=ECO:0000250 64..152 21/106 (20%)
GST_C_AIMP3 65..165 CDD:198338 22/108 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.