DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and gstt1a

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001314691.1 Gene:gstt1a / 563972 ZFINID:ZDB-GENE-031001-13 Length:242 Species:Danio rerio


Alignment Length:248 Identity:68/248 - (27%)
Similarity:122/248 - (49%) Gaps:42/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISLYGLDA-SPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWD 67
            :.|| ||. |.|.|:..:..|...:|||:..|:|...|.:.::|.|.:....||.|:|.|..:.:
Zfish     3 LELY-LDLHSQPCRSVFIFAKINKIPFEYKAVDLSAGEQYGDEFGKVSIIRKVPALKDGDFLLTE 66

  Fly    68 SHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVI---------FESALRRLTRPVLFFG 123
            |.||:.||..|::..|..||.||.:||:||:.:.::...|         |:..|..:|      |
Zfish    67 SIAILLYLAGKHSTPDHWYPADLQKRAQVDEFLSWQHTNIRSHGSKVFWFKGVLPAVT------G 125

  Fly   124 EPTLPRNQVDHILQVYD-----FVETFLDDHDFVAGDQLTIADF-SIVSTITSIGVFLELDPAKY 182
            .| :|:.::|..|:..:     |.:.||....|:.||::::||. :||..:..:...:::...: 
Zfish   126 AP-VPKEKMDSALEDLNMSLKIFEDKFLQSRPFIIGDKISLADIVAIVEMMQPVATGVDVFEGR- 188

  Fly   183 PKIAAWLERLKE---LPYYEEAN--------------GKGAAQFVELLRSKNF 218
            |.::||.:|:|:   :..::||:              .||..:|.:|...|.|
Zfish   189 PALSAWRDRVKKEVGVELFDEAHKVIMNVESLPQTFENKGLPEFFKLKIQKMF 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 26/73 (36%)
GstA 6..196 CDD:223698 60/208 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 32/149 (21%)
gstt1aNP_001314691.1 GstA 3..199 CDD:223698 59/204 (29%)
GST_N_Theta 3..78 CDD:239348 26/75 (35%)
GST_C_Theta 91..217 CDD:198292 30/133 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.