DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and gdap1l1

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:224 Identity:45/224 - (20%)
Similarity:74/224 - (33%) Gaps:81/224 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FSKKNPQHTVPLLQDDDACIWDSHAIMAYL--------VEKYAPSDELYP--------KDLLQRA 94
            |.:.|....||:....|..:.|.:.|:.|:        |.:..| ||..|        ::||...
Zfish    90 FMRLNLGEEVPVFIHGDTIVSDYNQIIDYIETNFVGDTVAQLIP-DEGTPMYARVQQYRELLDGL 153

  Fly    95 KVDQLMHFESGVIFE-------------------------SALRRLTRPVLFFGEPTLPRNQ--- 131
            .:|...|   |.|..                         |.|.:|........||.|.:.:   
Zfish   154 PMDAYTH---GCILHPELTTDSMIPKYATAEIRRHLANAASELMKLDHEEPQLTEPYLSKQKKLM 215

  Fly   132 ---VDH------------ILQVYDFVETFLDDHD----------FVAGDQLTIADFSIVSTITSI 171
               :||            :..|.|.||..|:...          ::.|...|:||..:.:|:..:
Zfish   216 AKILDHDNVNYLKKILGELAMVLDQVEAELEKRKLEYQGQKCELWLCGPTFTLADICLGATLHRL 280

  Fly   172 GVFLELDPAKY------PKIAAWLERLKE 194
             .||.|. .||      |.:.::.||:::
Zfish   281 -KFLGLS-RKYWEDGSRPNLQSFFERVQK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 8/38 (21%)
GstA 6..196 CDD:223698 45/224 (20%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/163 (19%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 45/224 (20%)
Thioredoxin_like 48..120 CDD:294274 8/29 (28%)
GST_C_GDAP1L1 201..311 CDD:198335 23/109 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589684
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.