DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and gdap1

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001018511.1 Gene:gdap1 / 553702 ZFINID:ZDB-GENE-050522-424 Length:362 Species:Danio rerio


Alignment Length:278 Identity:62/278 - (22%)
Similarity:94/278 - (33%) Gaps:84/278 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWD 67
            |:.||....|..::...|.:....|..|...|:|...|:....|.:.||...||:|..|:..|.|
Zfish    39 KLILYHWTQSFSSQKVRLAIAEKGLQCEDYDVSLPLSEHNEPWFMRLNPTGEVPVLVHDNHVICD 103

  Fly    68 SHAIMAYLVEKYAPSDELYPK-----------------DLLQRAKVDQLMHFESGVIF------- 108
            ...||.||.:.:.  ||..||                 :||...::|...|   |.|.       
Zfish   104 PTQIMDYLEQNFC--DEQTPKLIPEEGSTYYHRVQHYRELLDSLQMDAYTH---GCILHPEITVD 163

  Fly   109 ------------------ESALRRLT--RPVL--------------FFGEPTLP--RNQVDHILQ 137
                              ||.|::|.  .|.|              .|....:.  :..:|.:..
Zfish   164 SHIPAYATTHIRTQIGNTESELKKLAVENPDLKDAYIAKQRRLKSKLFDHDNMKYLKKLLDELEN 228

  Fly   138 VYDFVETFL-----------DDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKY------PKI 185
            |.|.|||.|           ....::.||..:|||.|:..|:..: .||.|. .:|      ..:
Zfish   229 VLDQVETELQRRSEETPEEGSQQAWLCGDFFSIADVSLAVTLHRL-KFLGLS-RRYWGNGMRVNL 291

  Fly   186 AAWLERLKELPYYEEANG 203
            ..:.||:.:.|.:....|
Zfish   292 ETYYERVLDRPTFRRVLG 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 22/72 (31%)
GstA 6..196 CDD:223698 59/266 (22%)
GST_C_Delta_Epsilon 91..209 CDD:198287 34/173 (20%)
gdap1NP_001018511.1 GstA 40..307 CDD:223698 60/273 (22%)
GST_N_GDAP1 40..112 CDD:239350 21/71 (30%)
GST_C_family 193..304 CDD:295467 24/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589738
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.