DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and CLIC6

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_016883895.1 Gene:CLIC6 / 54102 HGNCID:2065 Length:735 Species:Homo sapiens


Alignment Length:184 Identity:44/184 - (23%)
Similarity:71/184 - (38%) Gaps:41/184 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDSHAIMAYLVEKYAPSD 83
            :|.||.  :.|....|:|..|   ..|.....|....|.:..|.....|.:.|..:|.||.||  
Human   478 ILWLKG--VIFNVTTVDLKRK---PADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLEEKLAP-- 535

  Fly    84 ELYPK--------------------DLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLP 128
            ..|||                    ..::..|.|.....|..::  .|||:|..   :...| ||
Human   536 PRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIHEKNLL--KALRKLDN---YLNSP-LP 594

  Fly   129 RNQVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKY 182
             :::|    .|...:..:....|:.||:||:||.:::..:..|.|.|   |:::
Human   595 -DEID----AYSTEDVTVSGRKFLDGDELTLADCNLLPKLHIIKVHL---PSRH 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 14/57 (25%)
GstA 6..196 CDD:223698 44/184 (24%)
GST_C_Delta_Epsilon 91..209 CDD:198287 23/92 (25%)
CLIC6XP_016883895.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154375
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.