DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and Gstt3

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:240 Identity:71/240 - (29%)
Similarity:120/240 - (50%) Gaps:44/240 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKISLYGLD-ASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDAC 64
            || :.|| || .|.|.||..:..|...:||:...:.|.:.:::::.|::.||...||.|:|.|..
  Rat    58 MG-LELY-LDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFAQVNPLRKVPALKDGDFV 120

  Fly    65 IWDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALR---------RLTRPVL 120
            :.:|.||:.||..||...|..||:||..||:||:.:.::     .:|||         ::..|| 
  Rat   121 LAESVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQ-----HTALRSCCSRAMWQKMMFPV- 179

  Fly   121 FFGEPTLPRN------QVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTI---TSIG--VF 174
            |.|:|..|..      ::|..||:.:  :.||.:..|:.|..:::||...::.:   .|.|  :|
  Rat   180 FLGQPVPPERLASTLAELDGCLQMLE--DKFLQNKAFLTGPHISVADLVAITELMHPVSAGCKIF 242

  Fly   175 LELDPAKYPKIAAWLERLKELPYYEEANGKGAAQFVE--LLRSKN 217
                 ...||:|||.:|:      |.|.|:...|...  :|::|:
  Rat   243 -----ESRPKLAAWRQRV------EAAVGESLFQEAHEVVLKAKD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 25/73 (34%)
GstA 6..196 CDD:223698 63/210 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 34/137 (25%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 25/75 (33%)
GST_C_Theta 149..273 CDD:198292 35/142 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348136
Domainoid 1 1.000 62 1.000 Domainoid score I10049
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.650

Return to query results.
Submit another query.