DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and clic4

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001007908.1 Gene:clic4 / 493290 XenbaseID:XB-GENE-958154 Length:252 Species:Xenopus tropicalis


Alignment Length:175 Identity:41/175 - (23%)
Similarity:66/175 - (37%) Gaps:38/175 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDSHAIMAYLVEKYAPSD 83
            :|.||.  :.|....|:|..|   ..|.....|....|.:..:.....|.:.|..:|.|...|  
 Frog    43 ILWLKG--VVFNVTTVDLKRK---PADLQNLAPGTHPPFITYNHEVKTDVNKIEEFLEEVLCP-- 100

  Fly    84 ELYPKDLLQRAKVDQLMHFESGV----IFE--SALRRLTRPVLFFGEPTLPRNQVDHILQVYDFV 142
               ||.....||     |.||..    ||.  ||..:.:||   .....|.|..:..:.::.|::
 Frog   101 ---PKYRKLAAK-----HPESNTAGMDIFAKFSAYIKNSRP---DNNEALERGLLKTLQKLDDYL 154

  Fly   143 ---------ETFLDD-----HDFVAGDQLTIADFSIVSTITSIGV 173
                     |..:||     ..|:.|:::|:||.:::..:..|.|
 Frog   155 NSPLPDEIDENSMDDITQSNRKFLDGEEMTLADCNLLPKLHIIKV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 13/57 (23%)
GstA 6..196 CDD:223698 41/175 (23%)
GST_C_Delta_Epsilon 91..209 CDD:198287 24/103 (23%)
clic4NP_001007908.1 O-ClC 17..250 CDD:129941 41/175 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.