DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and clic5a

DIOPT Version :10

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001007386.1 Gene:clic5a / 492513 ZFINID:ZDB-GENE-041114-84 Length:246 Species:Danio rerio


Alignment Length:45 Identity:16/45 - (35%)
Similarity:22/45 - (48%) Gaps:4/45 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 DDHDFVAGDQLTIADFS--IVSTITSIGVFLE--LDPAKYPKIAA 187
            |.|:...|.......|:  :.:.:..|..|||  |.|.||||:||
Zfish    58 DLHNLAPGTPPPFLTFNGEVRTDVNKIEEFLEEMLAPPKYPKLAA 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GstA 6..209 CDD:440390 16/45 (36%)
clic5aNP_001007386.1 O-ClC 10..244 CDD:129941 16/45 (36%)

Return to query results.
Submit another query.