DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and GstD8

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster


Alignment Length:217 Identity:77/217 - (35%)
Similarity:125/217 - (57%) Gaps:9/217 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDS 68
            :..|....|.|.|:.::|.|||.:......:.:.:.|....:|.|.||||.:|.|.||...||:|
  Fly     1 MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWES 65

  Fly    69 HAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLPR--NQ 131
            .||:.||||||...|.|||.|..::|.|:|.::|:.|.:|:|.:..: .|.:....|..|.  .:
  Fly    66 RAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAI-YPQIRNNHPADPEAMQK 129

  Fly   132 VDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKEL- 195
            ||   ..:..::|||:|.::||||.|||||.::::::::..| ::.|.|:||.:|.|.|..||: 
  Fly   130 VD---SAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEV-VDFDIAQYPNVARWYENAKEVT 190

  Fly   196 PYYEEANGKGAAQFVELLRSKN 217
            |.:|| |..|.....:|::.:|
  Fly   191 PGWEE-NWDGVQLIKKLVQERN 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 26/72 (36%)
GstA 6..196 CDD:223698 70/192 (36%)
GST_C_Delta_Epsilon 91..209 CDD:198287 40/120 (33%)
GstD8NP_524916.1 GstA 1..188 CDD:223698 68/191 (36%)
GST_N_Delta_Epsilon 1..74 CDD:239343 26/72 (36%)
GST_C_Delta_Epsilon 88..204 CDD:198287 40/121 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460264
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.