DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and GstD3

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster


Alignment Length:209 Identity:71/209 - (33%)
Similarity:116/209 - (55%) Gaps:33/209 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDSHAIMAYLVEKYAPSDELYP 87
            |||.|.|....:|..:.|..:.||.|.||||::|.|.|:...||:|.||:.||||||...|.|||
  Fly     4 KALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYP 68

  Fly    88 KDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLPR------------NQVDH--ILQV 138
            ||:.::|.::|.::|:..:::                |||..            ::.|:  :.:.
  Fly    69 KDIQKQAVINQRLYFDMALMY----------------PTLANYYYKAFTTGQFGSEEDYKKVQET 117

  Fly   139 YDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKEL-PYYEEAN 202
            :||:.|||:..|:|||||.|:||.:|::.:::..| :..|.:|||.:|.|.:.:|:: |.:|| |
  Fly   118 FDFLNTFLEGQDYVAGDQYTVADIAILANVSNFDV-VGFDISKYPNVARWYDHVKKITPGWEE-N 180

  Fly   203 GKGAAQFVELLRSK 216
            ..||....:.:..|
  Fly   181 WAGALDVKKRIEEK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 24/53 (45%)
GstA 6..196 CDD:223698 64/187 (34%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/132 (27%)
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 24/53 (45%)
GstA 6..173 CDD:223698 62/183 (34%)
GST_C_Delta_Epsilon 72..188 CDD:198287 36/133 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460342
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.