DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and GstD2

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster


Alignment Length:203 Identity:72/203 - (35%)
Similarity:115/203 - (56%) Gaps:5/203 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDS 68
            :..|.:......|..::..|||.|......:|..|.|....:|.|.|||||:|.|.|:...||:|
  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWES 65

  Fly    69 HAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLPRNQVD 133
            .||..||||||...|.|.|.|..:||.::|.::|:.|.::|| ..:...|:...|:|....: :.
  Fly    66 RAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYES-FAKYYYPLFRTGKPGSDED-LK 128

  Fly   134 HILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKEL-PY 197
            .|...:.|::|||:..::|||||||:||.:|:||:::..| .|.|.:||..::.|.:..|:: |.
  Fly   129 RIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEV-SEFDFSKYSNVSRWYDNAKKVTPG 192

  Fly   198 YEEANGKG 205
            ::| |.:|
  Fly   193 WDE-NWEG 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 26/72 (36%)
GstA 6..196 CDD:223698 68/190 (36%)
GST_C_Delta_Epsilon 91..209 CDD:198287 38/116 (33%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 26/72 (36%)
GST_C_Delta_Epsilon 88..204 CDD:198287 38/116 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460251
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.