DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and gsto1

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:210 Identity:51/210 - (24%)
Similarity:87/210 - (41%) Gaps:39/210 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDA-CIWD 67
            |.||.:...|..:...|.|.|..:.::.:.:||..|.::   |.:|||...||:|:.... .|::
Zfish    23 IRLYSMRFCPFAQRTRLVLNAKGIKYDTININLKNKPDW---FLEKNPLGLVPVLETQSGQVIYE 84

  Fly    68 SHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLPRNQV 132
            |.....||.|.| |..:|.|.|..:||:...|:...|.|            ..:|.:..:.|.:.
Zfish    85 SPITCEYLDEVY-PEKKLLPFDPFERAQQRMLLELFSKV------------TPYFYKIPVNRTKG 136

  Fly   133 DHILQVYDFVETFLDD-------------HDFVAGDQLTIADFSI---VSTITSIGVFLELDPAK 181
            :.:    ..:||.|.|             ..|..||.:|:.|:.:   ...:.::.:...||.. 
Zfish   137 EDV----SALETELKDKLSQFNEILLKKKSKFFGGDSITMIDYMMWPWFERLETMNLKHCLDGT- 196

  Fly   182 YPKIAAWLERLKELP 196
             |::..|.||:.|.|
Zfish   197 -PELKKWTERMMEDP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 21/73 (29%)
GstA 6..196 CDD:223698 49/206 (24%)
GST_C_Delta_Epsilon 91..209 CDD:198287 24/122 (20%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 20/72 (28%)
GstA 25..210 CDD:223698 49/206 (24%)
GST_C_Omega 107..229 CDD:198293 24/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.